PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0042s0630.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 245aa    MW: 25964.8 Da    PI: 9.3293
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0042s0630.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702113.33.6e-351332283101
                  DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsst 89 
                             s t++CqdCGnqakkdC+h+RCRtCCksrgfdC thvkstWvpaa+rrerq +++a    a ++ +++  k++r    ++q+++s+t
  SapurV1A.0042s0630.3.p 133 SATTTCQDCGNQAKKDCSHRRCRTCCKSRGFDCVTHVKSTWVPAARRRERQLMATA-GGGAGSTGSTSGVKKPRLI--SSQTTTSHT 216
                             67899********************************************9765555.4566666688888888875..777888888 PP

                  DUF702  90 klssaeskkele 101
                             ++s+++ +  ++
  SapurV1A.0042s0630.3.p 217 STSNTTRSYDTS 228
                             888877665544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.7E-31135224IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.2E-27137179IPR006510Zinc finger, lateral root primordium type 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGMVGLRDVF VVAPAAFNHH HQHHEQINLS TADPINASNA TALGVGVIPL LTAAPCLAPQ  60
NMDDQDLMNN GRNKVSGIHQ FWQNQGSQYI KKASNTTPIL DHHNNSSTAN FLLQSGNSAG  120
NGSGSLGGNS SSSATTTCQD CGNQAKKDCS HRRCRTCCKS RGFDCVTHVK STWVPAARRR  180
ERQLMATAGG GAGSTGSTSG VKKPRLISSQ TTTSHTSTSN TTRSYDTSSS HQGFLLNCVC  240
RCRF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006379117.11e-119hypothetical protein POPTR_0009s07510g
RefseqXP_002313255.21e-119LATERAL ROOT PRIMORDIUM 1 family protein
SwissprotQ94CK91e-45LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLU5G3K71e-119U5G3K7_POPTR; Uncharacterized protein
TrEMBLB9HNF91e-119B9HNF9_POPTR; LATERAL ROOT PRIMORDIUM 1 family protein
STRINGPOPTR_0009s07510.11e-118(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.39e-40Lateral root primordium (LRP) protein-related